Protein Model on 1iq1_C_1_B_1 (TEMPLATE: 1iq1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA-2 SUBUNIT :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [9 aa] IMPORTIN ALPHA-2 SUBUNIT :IMA2_MOUSE 104L 105S 106R 107E 110P 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 270D 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1iq1_C_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
1iq1_C_1       3:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 102
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHHTSSS   HHHHHHTTHHHHHHHHHT GGGHHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbeebbebb:    
Contact         :                                bbbb  b                               b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
1iq1_C_1     103:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 202
SecStr          :T S HHHHHHHHHHHHHHHHH HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbbb:    
Contact         :         b  b   b  bb                                   b  b   b  b                               b 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
1iq1_C_1     203:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 302
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebbebbbebbbebbeeeeebbe:    
Contact         : b   b                                                                                              

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
1iq1_C_1     303:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 402
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTSHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeeeebbe:    

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
1iq1_C_1     403:KIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHHHTT SSHHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebeeebeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123