Protein Model on 1jdh_A_1_B_1 (TEMPLATE: 1jdh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [508 aa] BETA-CATENIN :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [38 aa] hTcf-4 :TF7L2_HUMAN 132D(N) 134S(K) 135P(F) 138F(I) 141A(D) 145T(Q) 149S(Y) 150G 155T(K) 179S(Y) 181Q(K) 184W 188N(R) 191G(K) 192D(V) 195V 219S(R) 234S(R) 235N 241N(D) 273W(G) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 312P 315R(C) 318G(R) 319N(H) 322T(S) 323G(R) 361N(K) 365G 368D(R) 369Q(N) 372Q(L) (identity: 21.1 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1jdh_A_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1jdh_A_1     142:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 237
SecStr          :HTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebebbebbbebbe:    
Contact         :              b bb  b  b   b   bb    b                       b b  b   b  bb  b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1jdh_A_1     238:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 329
SecStr          :SS HH-----HHHHHHHHHHHH---HTT TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeeeebbeb:    
Contact         :    b              bb     b                               b  bb bbb    b                           b

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQ--KEAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1jdh_A_1     330:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQXXXXXXX: 421
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHH -------:    
ExpBur          :bbbbbebbbbebebbeebbebbeeeeb-bebbbebbeee-------bebebbebbbbbbebbbebeebbeebeeeebbebbbebbeebeeeee-------:    
Contact         :  b  bb  bb                                         b   b  bb  b                                    

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1jdh_A_1     422:XXXXFVEGVRMEEIV: 436
SecStr          :---- BTTB HHHHH:    
ExpBur          :----eeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123