Protein Model on 1jpw_E_1_F_1 (TEMPLATE: 1jpw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) E 1 (C) polymer(polypeptide(L)) [502 aa] BETA-CATENIN :CTNB1_HUMAN
2 b F 1 (F) polymer(polypeptide(L)) [24 aa] transcription factor 7-like 2 :TF7L2_HUMAN 132D(N) 134S(K) 135P(F) 138F(I) 141A(D) 149S(Y) 150G 179S(Y) 181Q(K) 191G(K) 195V 219S(R) 231W 234S(R) 235N 241N(D) 244P(T) 276S 277Y(N) 280D(C) 281G(N) 286I(K) 312P 319N(H) 323G(R) 361N(K) (identity: 23.1 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1jpw_E_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1jpw_E_1     146:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 241
SecStr          :TTHHHHHHHGGG S HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTSSTTHHHHHHHTTHHHHHTTSSS:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbeebbbebbbebbe:    
Contact         :              b bb  b  b       bb                            b b         b   b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1jpw_E_1     242:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 333
SecStr          :SS HH-----HHHHHHHHHHHH---HTT TT S  HHHHHHHHHGGG S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbeebbebbebeeeebbbbbbbbbbebbbebeebbeebeeeebbebbbebbeebeeebebbeb:    
Contact         :    b           b  bb     b  b                               bb  bb    b                           b

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1jpw_E_1     334:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX: 425
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHH ------:    
ExpBur          :bbbbbebbbeebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbbbbebbbebeebbeebeeeebbeebbebbeebeeeeee------:    
Contact         :      b   b                                         b                                               

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1jpw_E_1     426:XXXXFVEGVRMEEIV: 440
SecStr          :---- GGG  HHHHH:    
ExpBur          :----eeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123