Protein Model on 1luj_A_1_B_1 (TEMPLATE: 1luj )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [501 aa] Catenin beta-1 :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [71 aa] Beta-catenin-interacting protein 1 :CNBP1_MOUSE 149S(Y) 150G 155T(K) 191G(K) 192D(V) 195V 234S(R) 235N 241N(D) 273W(G) 277Y(N) 280D(C) 281G(N) 286I(K) 318G(R) 319N(H) 323G(R) 368D(R) (identity: 16.7 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1luj_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1luj_A_1     127:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 222
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :ebbbeebbebbeeeeeebbbbbbb-bbbbbbeebeebbeebeeeebbeebbebbee---beeeebbbbbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                               bb    b                                   bb  b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1luj_A_1     223:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 314
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbeebbebbeeeeeebbbbbbbbbbebbeebeebbeebbeeebbeebbbbbeebeeebebbeb:    
Contact         :                   bb     b                               b   b  bb    b                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
1luj_A_1     315:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 400
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHT :    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebeeeebbebbbebbeebeeeeee:    
Contact         :     bb   b                                                b                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123