Protein Model on 1m1e_A_1_B_1 (TEMPLATE: 1m1e )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [512 aa] Beta-catenin :CTNB1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [65 aa] ICAT :CNBP1_HUMAN 149S(Y) 150G 151T(N) 152S(Q) 153E 155T(K) 194S 195V 197R(K) 234S(R) 235N 241N(D) 244P(T) 273W(G) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 312P 319N(H) 322T(S) 323G(R) (identity: 33.3 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1m1e_A_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1m1e_A_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbbbbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbbbbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                               bbbbb b                                      bb    b                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1m1e_A_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebbebeebeebbbbbbebbeeeeeebbbbbbbbbbebbbebeebbebbbeeebbebbbebbeebeeebebbeb:    
Contact         :                   bb     b  b                            b  bb bbb    b                           b

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1m1e_A_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX: 422
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHH ------:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeeeee------:    
Contact         :      b  bb                                                                                         

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1m1e_A_1     423:XXXQFVEGVRMEEIV: 437
SecStr          :--- EETTEEHHHHH:    
ExpBur          :---eeeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123