Protein Model on 1pjm_B_1_A_1 (TEMPLATE: 1pjm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [427 aa] Importin alpha-2 subunit :IMA2_MOUSE
2 b A 1 (A) polymer(polypeptide(L)) [20 aa] Retinoblastoma-associated protein :RB_HUMAN 104L 105S 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 234S 235N 238R 270D 273W 277Y 315R 319N 321V 322T 323G 328T 350N 357W 360S 361N 364A 396E 399W (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1pjm_B_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
1pjm_B_1       2:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 101
SecStr          : TTSS  HHHHHHHHHSS HHHHHHHHHHHHHHTTSSS   HHHHHHTT HHHHHHHHT GGGHHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHH:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbebbbeb:    
Contact         :                                 bb                                b   b   b bbbbb  b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
1pjm_B_1     102:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 201
SecStr          :TT S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHS   SS   HHHHHHHHHHHHHHTT S HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    
Contact         :          b  b   b  bb                                      b  bb  b                               b

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
1pjm_B_1     202:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 301
SecStr          :HHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeebb:    
Contact         :  b   b                                     b   b bbb    b                     b      b  bb  b      

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
1pjm_B_1     302:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 401
SecStr          :HHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTSH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeeeebb:    
Contact         :                         b  b                                                                       

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                :******* *********** *******:
1pjm_B_1     402:DKIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHTGGGG SSHHHHHHHHHHHHHS  :    
ExpBur          :eebeebeeeebeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123