Protein Model on 1q1s_C_1_A_1 (TEMPLATE: 1q1s )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [434 aa] Importin alpha-2 subunit :TALA_SV40
2 b A 1 (A) polymer(polypeptide(L)) [5 aa] Large T antigen :TALA_SV40 280D 281G 283N 319N 321V 322T 323G 325D 328T 357W 360S 361N 364A 396E 399W 402T 403N 406S (identity: 100.0 %/94.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1q1s_C_1 identity=94.2%
queryA        69:NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI: 168
                : ********* ******** * * ************************************* **************************************:
1q1s_C_1       6:SNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI: 105
SecStr          :STTSSSS  HHHHHHHHTSS HHHHHHHHHHHHHHHHSSS   HHHHHHTT HHHHHHHTT GGGHHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHH:    
ExpBur          :eeeebeeeeeeebeebbeeeeeeebbebbbbbbbbbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbbbbbbbbeeeeebbebbbeeebbeebb:    

queryA       169:SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVL: 268
                :************************** ******* ** *********** * ************************* **************** *****:
1q1s_C_1     106:SLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVL: 205
SecStr          :HHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHT   TT   HHHHHHHHHHHHHHTT S HHHH:    
ExpBur          :ebbebeeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebb:    

queryA       269:ADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD: 368
                :** *************** **** ************ ************************ **************************************:
1q1s_C_1     206:ADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD: 305
SecStr          :HHHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HH:    
ExpBur          :bebbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbeeeeeebbebbbebbbebbebeee:    
Contact         :           bb b                                   b bbb b  b                            b  bb  b    

queryA       369:QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECG: 468
                :*************** ************* ** **************************** ******* ******************************:
1q1s_C_1     306:QIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECG: 405
SecStr          :HHHHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTT:    
ExpBur          :bbeebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeee:    
Contact         :                           b  b  bb  b                                                              

queryA       469:GLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :********* *********** *******:
1q1s_C_1     406:GLDKIEALQRHENESVYKASLNLIEKYFS: 434
SecStr          :SHHHHHHHHT SSHHHHHHHHHHHHHH  :    
ExpBur          :bbeebeebbeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123