Protein Model on 1q1s_C_1_B_1 (TEMPLATE: 1q1s )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [434 aa] Importin alpha-2 subunit :TALA_SV40
2 b B 1 (B) polymer(polypeptide(L)) [15 aa] Large T antigen :TALA_SV40 104L 105S 106R 107E 110P 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 239N 270D 273W 277Y 306E 307L 308P 311T (identity: 100.0 %/94.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1q1s_C_1 identity=94.2%
queryA        69:NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI: 168
                : ********* ******** * * ************************************* **************************************:
1q1s_C_1       6:SNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFI: 105
SecStr          :STTSSSS  HHHHHHHHTSS HHHHHHHHHHHHHHHHSSS   HHHHHHTT HHHHHHHTT GGGHHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHH:    
ExpBur          :eeeebeeeeeeebeebbeeeeeeebbebbbbbbbbbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbbbbbbbbeeeeebbebbbeeebbeebb:    
Contact         :                                   bbbb  b                               b   b bbbbb  b             

queryA       169:SLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVL: 268
                :************************** ******* ** *********** * ************************* **************** *****:
1q1s_C_1     106:SLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVL: 205
SecStr          :HHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHT   TT   HHHHHHHHHHHHHHTT S HHHH:    
ExpBur          :ebbebeeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebb:    
Contact         :            b  b  bb  bb                                      b   b  bb                             

queryA       269:ADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD: 368
                :** *************** **** ************ ************************ **************************************:
1q1s_C_1     206:ADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD: 305
SecStr          :HHHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HH:    
ExpBur          :bebbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbeeeeeebbebbbebbbebbebeee:    
Contact         : b  b   b                            bbb  b                                                         

queryA       369:QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECG: 468
                :*************** ************* ** **************************** ******* ******************************:
1q1s_C_1     306:QIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECG: 405
SecStr          :HHHHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTT:    
ExpBur          :bbeebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeee:    

queryA       469:GLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :********* *********** *******:
1q1s_C_1     406:GLDKIEALQRHENESVYKASLNLIEKYFS: 434
SecStr          :SHHHHHHHHT SSHHHHHHHHHHHHHH  :    
ExpBur          :bbeebeebbeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123