Protein Model on 1q1t_C_1_B_1 (TEMPLATE: 1q1t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [427 aa] Importin alpha-2 subunit :TALA_SV40
2 b B 1 (B) polymer(polypeptide(L)) [11 aa] Large T antigen :TALA_SV40 104L 105S 106R 107E 108K 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 239N 270D 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1q1t_C_1 identity=94.4%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :********* ******** * * ************************************* ***************************************:
1q1t_C_1       7:NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 106
SecStr          : GGGSS  HHHHHHHHSSS HHHHHHHHHHHHHHTTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeeeeeeebeebbeeeeeeebbebbbbbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbeebbe:    
Contact         :                                  bbbbb b                           b   b   b bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :************************* ******* ** *********** * ************************* **************** ******:
1q1t_C_1     107:LLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLA: 206
SecStr          :HTT SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbb:    
Contact         :           b  b  bb  bb                                      b   b  bb                              

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :* *************** **** ************ ************************ ***************************************:
1q1t_C_1     207:DSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 306
SecStr          :HHHHHHHHHTSSSHHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHH:    
ExpBur          :ebbebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeeb:    
Contact         :b  b   b                                                                                            

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :************** ************* ** **************************** ******* *******************************:
1q1t_C_1     307:IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGG: 406
SecStr          :HHHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTS:    
ExpBur          :beebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeeeeb:    

queryA       470:LDKIEALQNHENESVYKASLSLIEKYF: 496
                :******** *********** ******:
1q1t_C_1     407:LDKIEALQRHENESVYKASLNLIEKYF: 433
SecStr          :HHHHHHHTT SSHHHHHHHHHHHHHH :    
ExpBur          :beebeebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123