Protein Model on 1qgk_B_1_A_1 (TEMPLATE: 1qgk )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [44 aa] PROTEIN (IMPORTIN ALPHA-2 SUBUNIT) :IMA2_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [876 aa] PROTEIN (IMPORTIN BETA SUBUNIT) :IMB1_HUMAN 11A 12A 13R 14L 16R 17F 18K 19N 20K 22K 27M 28R 31R 32I 34V 35N 38L 39R 40K 43K 47M 50R 51R 53V 54S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1qgk_B_1 identity=100.0%
queryA        11:AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS:  54
                :********************************************:
1qgk_B_1       1:AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS:  44
SecStr          :   GGGSTTTT SHHHHHHHHHHHHHHHHHHHHHHHHHHHHT  :    
ExpBur          :eeeeeeeeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :bbbb bbbbb b    bb  bb bb  bbb  b   b  bb bb                                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123