Protein Model on 1qz7_A_1_B_1 (TEMPLATE: 1qz7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [524 aa] Beta-catenin :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [17 aa] Axin :AXN_XENLA 132D(N) 134S(K) 138F(I) 181Q(K) 184W (identity: 20.0 %/28.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1qz7_A_1 identity=28.5%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1qz7_A_1     144:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 239
SecStr          :HTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHTT---   HHHHHHHHHHHHHHHTSTTHHHHHHHHTHHHHHGGGTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeebebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b b   b                                          b  b                                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1qz7_A_1     240:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 331
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---bebbeebeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbbbbbeeebbebbbebbeebeeebebbeb:    

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEAVWAV: 401
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1qz7_A_1     332:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT----: 419
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHHTSS----:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbebbebbbebeebbeebeeeebbebbbebbeebbeebeebe----:    

queryA       402:TNYTSGGTVEQIV: 414
                :     ***  * *:
1qz7_A_1     420:---SMGGTQQQFV: 429
SecStr          :---S SSSS   B:    
ExpBur          :---eeeeeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123