Protein Model on 1th1_A_1_C_1 (TEMPLATE: 1th1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [514 aa] Beta-catenin :CTNB1_HUMAN
2 b C 1 (C) polymer(polypeptide(L)) [56 aa] Adenomatous polyposis coli protein :APC_HUMAN 132D(N) 134S(K) 135P(F) 137Q(A) 138F(I) 141A(D) 149S(Y) 150G 155T(K) 179S(Y) 181Q(K) 184W 191G(K) 192D(V) 195V 219S(R) 231W 234S(R) 235N 241N(D) 244P(T) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 312P 318G(R) 319N(H) 322T(S) 323G(R) 361N(K) 368D(R) 369Q(N) (identity: 22.9 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1th1_A_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1th1_A_1     144:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 239
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHTT---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b bb bb  b       bb    b                       b b  b      bb  b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1th1_A_1     240:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 331
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT    HHHHHHHHHHTT S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eeeee-----bbbbbbebbeeb---beebeebeebeebbeebbebbeeeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeebebbeb:    
Contact         :    b           b  bb     b  b                               bb bbb    b                           b

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKEA--VW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1th1_A_1     332:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSXXX: 423
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHHHT  ---:    
ExpBur          :bbbbbebbbeebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeebeeeee---:    
Contact         :     bb  bb                                         b      bb                                       

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1th1_A_1     424:XXXQFVEGVRMEEIV: 438
SecStr          :--- EETTEEHHHHH:    
ExpBur          :---eeeeebebebbb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123