Protein Model on 2c1m_A_1_B_1 (TEMPLATE: 2c1m )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN-ALPHA2 SUBUNIT :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [46 aa] NUCLEOPORIN 50 KDA :NUP50_MOUSE 238R 240K 273W 277Y 307L 308P 311T 315R 321V 322T 323G 328T 348K 350N 354E 357W 360S 361N 364A 390D 391F 392K 396E 399W 403N 427N 428L 430T(S) 431A 432K 437I 458E 461S 462I 465E 470L 471D 474E 475A 477Q 478N(R) 479H 480E 481N 482E 485Y 489L 492I 493E 495Y 496F 497S 498V (identity: 96.2 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2c1m_A_1 identity=94.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :**** ******** * * ************************************* ********************************************:
2c1m_A_1       1:NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 100
SecStr          :   HHHHHHHHTSS HHHHHHHHHHHHHHHH SS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS TTHHHHHHHTTHHHHHHHHTT S:    
ExpBur          :eeebeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeeebebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebe:    

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :******************** ******* ** *********** * ************************* **************** ******* ***:
2c1m_A_1     101:HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA: 200
SecStr          :SHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT  S GGGS HHHHHHHHHHHHHHH   TT   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbebbeebbebbeebbeeebbeebbebbeeeebeebeeebbeebbebbbbbbeeeeebbeeebbeebbebbbebbebebeebbbbbbeb:    
Contact         :                                                               b b                                b 

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :************ **** ************ ************************ ********************************************:
2c1m_A_1     201:ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 300
SecStr          :HHHHHSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbbbbbebbebeeebbeebb:    
Contact         :  b                             bb  b   b     bbb    b                   b b   b  b  bb  b          

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :********* ************* ** **************************** ******* ************************************:
2c1m_A_1     301:NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 400
SecStr          :HTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeeebbbebbebbbbbbeebbeebbeebbeeebbebbbebbebeebebbebbbebbeebbebbeeeeeeeebbeebeeeebbeebe:    
Contact         :               bbb   b  b   b                       bb bbb    b                    b  bb  b    bb  b

queryA       475:ALQNHENESVYKASLSLIEKYFSV: 498
                :*** *********** ********:
2c1m_A_1     401:ALQRHENESVYKASLNLIEKYFSV: 424
SecStr          :HGGG SSHHHHHHHHHHHHHHS  :    
ExpBur          :ebeebeeeebeeebeebbeebbee:    
Contact         :b bbbbbb  b   b  bb bbbb                                                                            


Input Residue Numbers for Focused Sites

ex) 2,15,123