Protein Model on 2c1t_B_1_D_1 (TEMPLATE: 2c1t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [423 aa] IMPORTIN ALPHA SUBUNIT :IMA1_YEAST
2 b D 1 (D) polymer(polypeptide(L)) [39 aa] NUCLEOPORIN NUP2 :NUP2_YEAST 231W 234S 235N 238R 239N(G) 240K 270D 273W 277Y 280D 311T 315R 321V 322T 323G 328T 348K 350N 357W 360S 361N 364A 396E 399W 432K(A) 434T(N) 465E 470L(M) 474E(F) 477Q 478N(Q) 479H(N) 480E 482E(D) 485Y 489L(Y) 492I 496F (identity: 76.3 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2c1t_B_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
2c1t_B_1       5:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 104
SecStr          :HHHHHT S HHHHHHHHHHHHHHHT SSS  HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :bbebbeeeeeeebeebbeebbeebeeeeeebbeebbeeebbebbbebbeeeeeeebbbbbbebbbebbeeeeebbeebbeeebbebbbebbeebeeebee:    

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
2c1t_B_1     105:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 199
SecStr          :HHHHHHHHHHHS HHHHHHHHHTT HHHHHHGG-----G   HHHHHHHHHHHHHHH  STT   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbbeeeebbeebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbebbbebbe:    
Contact         :                                                  b  bb  bbb                             b  b   b  b

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
2c1t_B_1     200:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 299
SecStr          :S HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHHT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbeebbebbebeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebeebebbebbbebbbebbeeebebbeebbebebbe:    
Contact         :                              b   b     bbb    b                   b b      b  bb  b                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
2c1t_B_1     300:PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 399
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHTTTTTT HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHHHHHHTT S  HHHHHHHHTTHHHHH:    
ExpBur          :bbbebbeebeeebeeebbebbbbbbebbeeeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbbebbeebbeeeeeeebebbeebeebebeebb:    
Contact         :               b  b                                  b b                                   b    b   

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
2c1t_B_1     400:FNCQQNENDKIYEKAYKIIETYF: 422
SecStr          :HHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :eebeebeeeebeebbeebbeebb:    
Contact         :b  bbbb b  b   b  b   b                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123