Protein Model on 2gl7_D_1_E_1 (TEMPLATE: 2gl7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [506 aa] Beta-catenin :CTNB1_HUMAN
2 b E 1 (E) polymer(polypeptide(L)) [28 aa] Transcription factor 7-like 2 :TF7L2_HUMAN 132D(N) 134S(K) 138F(I) 141A(D) 145T(Q) 146N(I) 149S(Y) 150G 155T(K) 179S(Y) 181Q(K) 184W 191G(K) 192D(V) 195V 219S(R) 234S(R) 235N 241N(D) 277Y(N) 280D(C) 281G(N) 286I(K) 315R(C) 318G(R) 319N(H) 322T(S) 323G(R) 361N(K) 365G 369Q(N) 372Q(L) (identity: 15.6 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2gl7_D_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
2gl7_D_1     140:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 235
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---beeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b b   b  b   bb  bb    b                       b b  b      bb  b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
2gl7_D_1     236:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 327
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT    HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbebbbeeebbebbbebbeebeeebebbeb:    
Contact         :    b              bb     b                                   b  bb    b                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
2gl7_D_1     328:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX: 419
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHH ------:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbebbebbbebeebbeebeeeebbebbbebbeebbeeeee------:    
Contact         :  b  bb  bb                                         b   b   b  b                                    

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
2gl7_D_1     420:XXXXFVEGVRMEEIV: 434
SecStr          :---- BTTB HHHHH:    
ExpBur          :----eeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123