Protein Model on 2jdq_A_1_B_1 (TEMPLATE: 2jdq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN 214A(S) 254P(N) 257V(S) 258R(W) 261H(F) 287G(Q) 290V(I) 291K(D) 292T(A) 293G 296P(R) 326E(I) 327Q 330V 333D(N) (identity: 20.0 %/50.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2jdq_A_1 identity=50.7%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
2jdq_A_1      24:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 123
SecStr          :HHHHHHHSS HHHHHHHHHHHHHHHHSSSS  HHHHHTSTTHHHHHHHHHT TT HHHHHHHHHHHHHHHSS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :ebeebbeeeeeeebbebbeebbeebeeeeeeebeebbebeebbebbbebbeeeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
2jdq_A_1     124:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 219
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHTTS   HHHH----HHHHHHHHHHH  SSS   GGGTGGGHHHHHHHTT   HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeeeebbeebbeeebbebbbebbeeebeeebb----ebbbebbbbbbeeeeeebeeeebeebbebbbebbeeebeebbbebbebbbbb:    
Contact         :                                   b                                       b  bb  b                 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
2jdq_A_1     220:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 319
SecStr          :TSSSHHHHHHHHHTTTHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTH:    
ExpBur          :beeeeebbeebbebebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebeebbbebbbebbebeeebbeebbeeeb:    
Contact         :        b  bbbb  b                             bb  b  b                                             

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
2jdq_A_1     320:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 419
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHHT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHHS S   HHHHHHHHHH HHHH:    
ExpBur          :beebbebbeebeeebebbbbebbbbbbeebbbebbeebbeeebbebbbebbeeeeeebeebbeebbebbeebbeebbeeeeeeebebeeebeebeeeeeb:    

queryA       474:EALQNHENESVYKASLSLIEKYFSVE: 499
                :* ** ***   *     *** **  *:
2jdq_A_1     420:EFLQSHENQEIYQKAFDLIEHYFGTE: 445
SecStr          :HHHH HHHHHHHHHHHHHHHHHH   :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123