Protein Model on 2jdq_A_1_D_1 (TEMPLATE: 2jdq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN
2 b D 1 (E) polymer(polypeptide(L)) [65 aa] POLYMERASE BASIC PROTEIN 2 :PB2_IAVI7 104L 105S 107E 110P 138F 142W 146N 148A 149S 150G 151T(N) 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 240K 273W 277Y 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 357W 360S 361N 364A 365G 366R(N) 367Q(R) 396E 399W 402T 403N 406S 407G 435K 438L(Q) 442D(N) 498V(T) (identity: 88.2 %/50.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2jdq_A_1 identity=50.7%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
2jdq_A_1      24:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 123
SecStr          :HHHHHHHSS HHHHHHHHHHHHHHHHSSSS  HHHHHTSTTHHHHHHHHHT TT HHHHHHHHHHHHHHHSS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :ebeebbeeeeeeebbebbeebbeebeeeeeeebeebbebeebbebbbebbeeeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    
Contact         :                        bb b  b                            b   b   b bbbb   b                       

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
2jdq_A_1     124:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 219
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHTTS   HHHH----HHHHHHHHHHH  SSS   GGGTGGGHHHHHHHTT   HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeeeebbeebbeeebbebbbebbeeebeeebb----ebbbebbbbbbeeeeeebeeeebeebbebbbebbeeebeebbbebbebbbbb:    
Contact         :  b  b   b  bb                                   b  b   b  b b                                b   b 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
2jdq_A_1     220:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 319
SecStr          :TSSSHHHHHHHHHTTTHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTH:    
ExpBur          :beeeeebbeebbebebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebeebbbebbbebbebeeebbeebbeeeb:    
Contact         : bb b  b                            b   b bbb    b                            b  bb  bbbb           

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
2jdq_A_1     320:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 419
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHHT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHHS S   HHHHHHHHHH HHHH:    
ExpBur          :beebbebbeebeeebebbbbebbbbbbeebbbebbeebbeeebbebbbebbeeeeeebeebbeebbebbeebbeebbeeeeeeebebeeebeebeeeeeb:    
Contact         :                 b  b  bb  bb                           b  b   b                                    

queryA       474:EALQNHENESVYKASLSLIEKYFSVE: 499
                :* ** ***   *     *** **  *:
2jdq_A_1     420:EFLQSHENQEIYQKAFDLIEHYFGTE: 445
SecStr          :HHHH HHHHHHHHHHHHHHHHHH   :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :                        b                                                                           


Input Residue Numbers for Focused Sites

ex) 2,15,123