Protein Model on 2ru4_A_1_B_1 (TEMPLATE: 2ru4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [115 aa] Armadillo Repeat Protein, N-terminal fragment, YIIM2
2 b B 1 (B) polymer(polypeptide(L)) [84 aa] Armadillo Repeat Protein, C-terminal fragment, MAII 308P(Q) 309I(E) 310V(Q) 312P(S) 313A 314L(T) 315R 317I(F) 367Q(N) 379V(L) 383V 386L 391F(E) 394Q(L) 395K(Q) 398V(L) 399W 401V(L) 402T(S) 404Y(I) 405T(A) 406S 407G (identity: 30.4 %/39.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ru4_A_1 identity=39.1%
queryA       293:GVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFK: 392
                :*  **    *          * *    *     ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **     :
2ru4_A_1       1:GELPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ: 100
SecStr          :                  S           S TTHHHHH  SSSHHHHHHGGGSS HHHHHHHHHHHHHHHTT HHHHHHHHTTTHHHHHHHGGGSS HH:    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebbeeebeeeeeeebebebeebebeeeeebbebbebbbbbbbeeeebbeebbeeebeebbeebeebeeee:    
Contact         :               bbb bbbb b                                                 b           b   b  b    b 

queryA       393:TQKEAVWAVTNYTSG: 407
                :   ** **  *  **:
2ru4_A_1     101:ILQEALWALSNIASG: 115
SecStr          :HHHHHHHHHHHHHT :    
ExpBur          :beebbeebeebbeee:    
Contact         : bb  bb bb bbbb                                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123