Protein Model on 2ru4_B_1_A_1 (TEMPLATE: 2ru4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [84 aa] Armadillo Repeat Protein, C-terminal fragment, MAII
2 b A 1 (A) polymer(polypeptide(L)) [115 aa] Armadillo Repeat Protein, N-terminal fragment, YIIM2 327Q 330V(A) 331V 334A 335G 339V(A) 343L 348K(N) 350N(Q) 351I 354E 355A 357W 358T(A) 361N 362I 364A(S) 370I(K) 371Q 374V(K) 399W(E) 402T(E) 403N(K) 405T(Q) 406S (identity: 52.0 %/41.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ru4_B_1 identity=41.5%
queryA       325:DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                : ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
2ru4_B_1       2:NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS:  83
SecStr          : TTHHHHHHHTSHHHHHHHTT S HHHHHHHHHHHHHHHT SSSTTHHHHHHT HHHHHHHTTSS HHHHHHHHHHHHHH  :    
ExpBur          :eeebeeeeeeebbeebeeebebeeeeebbebbeebbebbeeeeebeebbeebebeebbeebbeeeeeebeeebeebbebbee:    
Contact         :  b  bb  bb   b   b    b bb  bb bb  bb b     bb  b                        b  bb bb                  


Input Residue Numbers for Focused Sites

ex) 2,15,123