Protein Model on 2yns_A_1_C_1 (TEMPLATE: 2yns )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] IMPORTIN SUBUNIT ALPHA-1A :IMA1A_ORYSJ
2 b C 1 (C) polymer(polypeptide(L)) [9 aa] B54NLS 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W 402T(S) 403N 406S 435K(R) 438L(T) 439V 442D(E) 446N 483S(E) (identity: 80.8 %/52.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2yns_A_1 identity=52.3%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*      *  *     ** **   ***** *  ***   *  *  * ** ** * *    *** ************* ** * * ** * *  ** *   :
2yns_A_1      37:SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSD: 136
SecStr          : HHHHHHHHTSS HHHHHHHHHHHHHHHS SS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S H:    
ExpBur          :eeeebeebbebeeeeebbebbeebbeebeeeeeeebeebbebebbebbbebbebeebeebbbbbbebbbbbbeeeeebbeebeeeebbeebbebbebebe:    

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********* ***    ****   **  **** *      *     *** ****** ** * * *        ** * ** *  * *** * *** *:
2yns_A_1     137:DVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLIHSNDEEVLTDACWALS: 231
SecStr          :HHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHT STT  HHH----HHHHHHHHHHHH SS-S   HHHHTTHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeeeeebbeebbeeebbeebbeebeeebeeeb----eebbbebbbbbbeee-eebebeebeebbebbbebbeeebeebbbbbbebbb:    

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :** ** *  *  *   ** * ** **         ****  ****** * ***  **  **    **** * *  * *** ** ******  **** * *:
2yns_A_1     232:YLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN: 331
SecStr          :HHTSSSHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHS   HHHHHHHHHHHHHHTTS HHHHHHHHH:    
ExpBur          :bbbeeeeebbebbbeeebbebbbebbeeebeebbebbbebbbbbbebeeebbeebbeeebbebbbebbeeeeeeebbebbbebbbebbebeeebbeebbe:    
Contact         :   bb b  b                            b   b bbb    b                          b  b  bb  b           

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEE: 466
                : *    **  *  * *   *** **  * ****   ** ***  * * **  **   *  *  * *    **     * *** *          * ** *:
2yns_A_1     332:AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDE: 427
SecStr          :TT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHH----HHHHHHHHHTT SS HHHHHHHH:    
ExpBur          :eebbeebbebbeebeeebeeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbb----ebbeebeeeeeeeebebbeebee:    
Contact         :                    b  b  bb  b                            b  bb  b   b                             

queryA       467:CGGLDKIEALQNHENESVYKASLSLIEKYF: 496
                :  ** *** ** * *   *       * * :
2yns_A_1     428:AEGLEKIENLQSHDNNEIYEKAVKILEAYW: 457
SecStr          :TTHHHHHHHGGG S HHHHHHHHHHHHHH :    
ExpBur          :bebbebbeebeeeeeeebeebbbebbeebe:    
Contact         :                b                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123