Protein Model on 2z6h_A_1_A_4 (TEMPLATE: 2z6h )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [533 aa] Catenin beta-1 :CTNB1_HUMAN
2 b A 4 (A) polymer(polypeptide(L)) [533 aa] Catenin beta-1 :CTNB1_HUMAN 296P(E) 331V(R) 332I(L) 333D(H) 334A(Y) 345T(H) 377G 380P 383V 384S(Q) (identity: 30.0 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2z6h_A_1 identity=27.8%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
2z6h_A_1     139:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 234
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHTT---   HHHHHHHHHHHHHHTT TTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbebbeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
2z6h_A_1     235:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 326
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT  S HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbbbbbeeebbebbbebbeebeebbebbee:    
Contact         :                                                                                 b                  

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQKE: 396
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **  :
2z6h_A_1     327:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR: 413
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTTH-HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHTT :    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------bebebbebbbebbebbbebeebbeebeeeebbebbbebbeebbeeeeee:    
Contact         :                b     bbbb          b                                b  bbbb  b  bb                 


Input Residue Numbers for Focused Sites

ex) 2,15,123