Protein Model on 3bct_A_2_C_2 (TEMPLATE: 3bct )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 2 (A) polymer(polypeptide(L)) [457 aa] BETA-CATENIN :CTNB1_MOUSE
2 b C 2 (A) non-polymer(URE) UREA 177H(Y) (identity: 0.0 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3bct_A_2 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
3bct_A_2      84:AGGLQKUVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIURT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGUQALGLHLT: 179
SecStr          :TTHHHHHHHHTT   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbbbbbebbebbbebeebeebbbebbbbebbbebbe:    
Contact         :                                                           b                                        

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **         *   *    **   *       *  *:
3bct_A_2     180:DPSQR-----LVQNCLWTLRNL---SDAATKQEGUEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKUUVCQVGGIEALVRTVLRAGDREDITEP: 271
SecStr          : S HH-----HHHHHHHHHHHH---STT    SS HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beeeeeeeebeebbeebbebbeeeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeebebbeb:    

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
3bct_A_2     272:AICALRHLTSRHQEAEUAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 357
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHT :    
ExpBur          :bbbbbebbbbebeebeebbbbbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebeeeebbeebbebbeebbeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123