Protein Model on 3fex_C_1_A_1 (TEMPLATE: 3fex )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [423 aa] Importin subunit alpha-2 :IMA2_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [756 aa] Nuclear cap-binding protein subunit 1 :NCBP1_HUMAN 101R 104L 105S 106R 107E 110P 142W 146N 148A 149S 150G 151T 152S 155T 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y 315R 321V 322T 323G 325D 328T 354E 357W 360S 361N 364A 365G 396E 399W 403N (identity: 100.0 %/98.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3fex_C_1 identity=98.8%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :*****************  *********************************************************************************:
3fex_C_1       2:NQGTVNWSVDDIVKGINXXNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 101
SecStr          : STTSS  HHHHHHHH -- HHHHHHHHHHHHHHTT SS   HHHHHTTTHHHHHHHHHT SS HHHHHHHHHHHHTTTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeebeeeebeebbe--eeeebeebbebbbebbeeeeeebbeebeeeebbeebeebbeeeebbebbbbbbebbbbbbeeeeebbeebbeeebbebbbe:    
Contact         :                               b  bbbb  b                               b   b bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :**********************************************   ***************************************************:
3fex_C_1     102:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVXXXSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 201
SecStr          :HTS S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHTT  ---  S HHHHHHHHHHHHTTT   SS   SHHHHTTHHHHHHTTT   HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeeebebbeebbeeebbeebbeebee---eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbb:    
Contact         :              b   b  bb                                   b  b   b  b                               

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :****************************************************************************************************:
3fex_C_1     202:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 301
SecStr          :HHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS SHHHHHHHHTTGGGTHHHHHT S HHHHHHHHHHHHHHHTS HHH:    
ExpBur          :bbbebbbbbbeeeeebbbbbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbeeeeeebbebbbebbbebbebeeeb:    
Contact         :   b   b                                     b     bbb b  b                         b  b  bb  bb    

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :****************************************************************************************************:
3fex_C_1     302:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 401
SecStr          :HHHHHHTT HHHHHHHHHTS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHTTTT S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTSH:    
ExpBur          :beebbeeebbeebbebbeebeeebbbbbbebbbebbeebbbebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeeeeb:    
Contact         :                          b  b   b                                                                  

queryA       470:LDKIEALQNHENESVYKASLSLIEKYF: 496
                :***************************:
3fex_C_1     402:LDKIEALQNHENESVYKASLSLIEKYF: 428
SecStr          :HHHHHTTTT S HHHHHHHHHHHHHH :    
ExpBur          :beebeebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123