Protein Model on 3fey_C_1_A_1 (TEMPLATE: 3fey )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [428 aa] Importin subunit alpha-2 :IMA2_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [761 aa] Nuclear cap-binding protein subunit 1 :NCBP1_HUMAN 101R 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 240K 273W 277Y 315R 321V 322T 323G 325D 328T 354E 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/99.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3fey_C_1 identity=99.3%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :****************************************************************************************************:
3fey_C_1       2:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 101
SecStr          : BTTBS  HHHHHHHHTSS HHHHHHHHHHHHHHHTSSS   HHHHHHTTHHHHHHHHHH TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeebeeeebeebbeeeeeeebeebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebbebbebbbebbbbbbeeeeebbebbbeeebbeebbe:    
Contact         :                               b  bbbb  b                           b   b   b bbbb   b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :**********************************************   ***************************************************:
3fey_C_1     102:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVXXXSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 201
SecStr          :HTT SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT  ---  S HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTTS  HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebee---eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbeeebeebbb:    
Contact         :           b  b   b  bb                                   b  b   b  b b                             

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :****************************************************************************************************:
3fey_C_1     202:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 301
SecStr          :HHHHHHHHHHSS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHHT S HHHHHHHHHHHHHHTTS HHH:    
ExpBur          :ebbebbbebbeeeeebbbbbbeeebbebbbebbebeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeeb:    
Contact         :   b   b                                     b     bbb b  b                         b  b  bb  b     

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :****************************************************************************************************:
3fey_C_1     302:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 401
SecStr          :HHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeebeeebbebbbebbbbbbeebbbebbeebeebebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeebb:    
Contact         :                          b  b   b                                                                  

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFSVE: 499
                :******************************:
3fey_C_1     402:LDKIEALQNHENESVYKASLSLIEKYFSVE: 431
SecStr          :HHHHHHGGG S HHHHHHHHHHHHHHS   :    
ExpBur          :beebeebeeeeeeebeeebbebbeebbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123