Protein Model on 3knd_A_1_B_1 (TEMPLATE: 3knd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [428 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [16 aa] Targeting protein for Xklp2 :Q9I8N0_XENLA 104L 105S 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 228N 231W 235N 238R 240K 270D 273W 281G 283N 286I 311T 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3knd_A_1 identity=94.4%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :********* ******** * * ************************************* ***************************************:
3knd_A_1       1:NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 100
SecStr          : GGGSS  HHHHHHHHTSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeeeeeeebeebbeeeeeeebbebbbbbbbbbeeeeeebbeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbeebbeeebbebbbe:    
Contact         :                                  bb    b                           b   b   b bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :************************* ******* ** *********** * ************************* **************** ******:
3knd_A_1     101:LLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLA: 200
SecStr          :HTT SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHTT  SS   HHHHHHHHHHHHHHTT S HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbb:    
Contact         :           b  b  bb  bb                                   b  b   b  b b                             

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :* *************** **** ************ ************************ ***************************************:
3knd_A_1     201:DSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 300
SecStr          :HHHHHHHHHTSSSHHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHH:    
ExpBur          :ebbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeeb:    
Contact         :b  b       b b  b                        b   b   b bbb    b                         b  b  bb  b     

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :************** ************* ** **************************** ******* *******************************:
3knd_A_1     301:IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGG: 400
SecStr          :HHHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHTTTH:    
ExpBur          :beebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbeebbebbeeeeeeeebbeebeebeb:    
Contact         :                          b  b   b                                                                  

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :******** *********** *******:
3knd_A_1     401:LDKIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHHHHTTS SSHHHHHHHHHHHHHH  :    
ExpBur          :bebbeebeeeebeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123