Protein Model on 3l3q_A_1_B_1 (TEMPLATE: 3l3q )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [427 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [9 aa] pepTM 104L 105S 107E 110P 138F 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3l3q_A_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
3l3q_A_1       1:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 100
SecStr          :  SSS  HHHHHHHHTSS HHHHHHHHHHHHHHHHH SS  HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHG:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbebbbbbbeeeeeeebeebeeeebbeebbebbeeeebeebbbbbbebbbebbeeeeebbebbbeeebbeebbeb:    
Contact         :                                 bb b  b                           b   b   b bbbb   b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
3l3q_A_1     101:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 200
SecStr          :GG S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHSS   TT   HHHHHHHHHHHHHHTTSS HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    
Contact         :          b  b   b  bb                                   b  b   b  b                                

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
3l3q_A_1     201:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 300
SecStr          :HHHHHHHHTSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTGGGGHHHHHT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebb:    
Contact         :  b   b                                                                                             

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
3l3q_A_1     301:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 400
SecStr          :HHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHHTHH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebb:    

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                :******* *********** *******:
3l3q_A_1     401:DKIEALQRHENESVYKASLNLIEKYFS: 427
SecStr          :HHHHHTTS S HHHHHHHHHHHHHHT :    
ExpBur          :eebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123