Protein Model on 3l3q_A_1_C_1 (TEMPLATE: 3l3q )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [427 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b C 1 (C) polymer(polypeptide(L)) [6 aa] pepTM 281G 282P 283N 286I 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3l3q_A_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
3l3q_A_1       1:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 100
SecStr          :  SSS  HHHHHHHHTSS HHHHHHHHHHHHHHHHH SS  HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHG:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbebbbbbbeeeeeeebeebeeeebbeebbebbeeeebeebbbbbbebbbebbeeeeebbebbbeeebbeebbeb:    

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
3l3q_A_1     101:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 200
SecStr          :GG S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHSS   TT   HHHHHHHHHHHHHHTTSS HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
3l3q_A_1     201:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 300
SecStr          :HHHHHHHHTSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTGGGGHHHHHT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebb:    
Contact         :          bbb  b                            b   b bbb    b                         b  b  bb  b      

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
3l3q_A_1     301:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 400
SecStr          :HHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHHTHH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebb:    
Contact         :                         b  b                                                                       

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                :******* *********** *******:
3l3q_A_1     401:DKIEALQRHENESVYKASLNLIEKYFS: 427
SecStr          :HHHHHTTS S HHHHHHHHHHHHHHT :    
ExpBur          :eebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123