Protein Model on 3ouw_A_1_B_1 (TEMPLATE: 3ouw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [496 aa] Catenin beta-1 :CTNB1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [28 aa] Lymphoid enhancer-binding factor 1 :LEF1_MOUSE 132D(N) 134S(K) 137Q(A) 138F(I) 181Q(K) 185A(T) 234S(R) 235N 241N(D) 244P(T) 273W(G) 276S 277Y(N) 280D(C) 281G(N) 286I(K) 319N(H) 323G(R) 368D(R) 372Q(L) (identity: 10.0 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ouw_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
3ouw_A_1     145:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 240
SecStr          :TTHHHHHHHTTT   HHHHHHHHH-HHHHHHTT HHHHHHHHHHTHHHHHHHHHHH---   HHHHHHHHHHHHHHTSSTTHHHHHHHTTHHHHHTTSTT:    
ExpBur          :ebbbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b b  bb                                          b   b                                

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
3ouw_A_1     241:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 332
SecStr          : S HH-----HHHHHHHHHHHH---TTGGGG    HHHHHHHHHHTT S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHTTTT HHHHHH:    
ExpBur          :eeeee-----bbebbbebbeeb---beebeebeebeebbbbbbebbeeeeeebbbbbbebbbebbeebeebbbebbeeebbebbbebbeebeeeeebbeb:    
Contact         :                   bb     b  b                            b  bb  bb    b                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
3ouw_A_1     333:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 418
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHTTTHHHHHHHHHHHHTTTTT :    
ExpBur          :bbbbbeebbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeeeee:    
Contact         :      b   b                                                b   b                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123