Protein Model on 3oux_A_1_B_1 (TEMPLATE: 3oux )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [503 aa] Catenin beta-1 :CTNB1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [47 aa] Lymphoid enhancer-binding factor 1 :LEF1_MOUSE 132D(N) 134S(K) 135P(F) 137Q(A) 138F(I) 141A(D) 181Q(K) 184W 185A(T) 218M(Q) 219S(R) 227R(Q) 231W 234S(R) 235N 241N(D) 264D 265P(I) 266E(N) 267V 273W(G) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 319N(H) 322T(S) 323G(R) 361N(K) 368D(R) (identity: 21.9 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3oux_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
3oux_A_1     145:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 240
SecStr          :HTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :ebbbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              b bb bb  b                                       b  bb                                

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
3oux_A_1     241:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 332
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT S  HHHHHHHHHHTT S HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :bebee-----bbebbbebbeeb---beebeebeebeebbbebbebbeeeeeebbbbbbebbbebbeebeebbbebbeeebbebbbebbeebeeeeebbee:    
Contact         :   bb       b   b  bb     b                      bbbb     b  bb bbb    b                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
3oux_A_1     333:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 418
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTTH-HHHHHHTTSTT-------  HHHHHHHHHHHHHHHTSGGGHHHHHHTTHHHHHHHHHHHHHHHH  :    
ExpBur          :bbbbbebbbbebebbeebbebbeeeeb-bebbbebbeee-------beeebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeeeee:    
Contact         :      b  bb                                         b      b                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123