Protein Model on 3q5u_A_1_B_1 (TEMPLATE: 3q5u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [423 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [8 aa] Phospholipid scramblase 4 :PLS4_HUMAN 281G 283N 315R 319N 321V 322T 354E 357W 360S 361N 364A 395K 396E 399W 403N 406S 407G (identity: 100.0 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3q5u_A_1 identity=94.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :**** ******** * * ************************************* ********************************************:
3q5u_A_1       6:NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 105
SecStr          :   HHHHHHHHHSS HHHHHHHHHHHHHHTT SS   HHHHHHTTHHHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbeebbebbebe:    

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :******************** ******* ** *********** * ************************* **************** ******* ***:
3q5u_A_1     106:HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA: 205
SecStr          : HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHHT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebbeb:    

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :************ **** ************ ************************ ********************************************:
3q5u_A_1     206:ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 305
SecStr          :HHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbeebb:    
Contact         :      b b                               b   b bb                               b  b  bb  b          

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :********* ************* ** **************************** ******* ************************************:
3q5u_A_1     306:NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 405
SecStr          :HTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeebeeebbebbbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbbebbeeeeeeeebbeebeeeebeeebe:    
Contact         :                    bb  b   b  bb                                                                   

queryA       475:ALQNHENESVYKASLSLIEKYFS: 497
                :*** *********** *******:
3q5u_A_1     406:ALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HGGG SSHHHHHHHHHHHHHH  :    
ExpBur          :ebbeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123