Protein Model on 3tj3_A_1_B_1 (TEMPLATE: 3tj3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b B 1 (C) polymer(polypeptide(L)) [51 aa] Nuclear pore complex protein Nup50 :NUP50_HUMAN 191G 234S 235N 238R 240K 273W 277Y 307L(Y) 308P(K) 311T(S) 315R 321V 322T 323G 328T 348K 357W 360S 361N 364A 391F 392K(R) 394Q(R) 396E 399W 430T 431A(V) 432K(M) 465E 470L 471D 474E 475A(F) 476L 477Q 478N(S) 479H 480E 482E(Q) 485Y 489L(F) 492I 493E 496F 497S(G) 498V(T) 499E (identity: 72.3 %/50.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tj3_A_1 identity=50.7%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
3tj3_A_1      21:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 120
SecStr          :HHHHHHHSS HHHHHHHHHHHHHHHT SS   HHHHHHSTTHHHHHHHHTT TT HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHTTSS HHH:    
ExpBur          :ebeebbeeeeeeebeebbeebbeebeeeeeebbeebeeeeebbeebbebbebeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
3tj3_A_1     121:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 216
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHHTS   HHHH----HHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbebbeeeeebbeebbeeebbebbbebbeeebeeebb----eebbebbbbbbeeeeeebebeebeebbebbbebbeeebeebbbbbbebbbeb:    
Contact         :            b                                          bb  b b                                b   b 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
3tj3_A_1     217:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 316
SecStr          :TSS HHHHHHHHHTS HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT :    
ExpBur          :beeeeebbebbbeeebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbbbbbebbbebbebeeebbeebbeeeb:    
Contact         :                            bb  b   b     bbb    b                   b        b  bb  b              

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
3tj3_A_1     317:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 416
SecStr          :HHHHHHHTTSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHTTTT S HHHHHHHHHHHHHHHHHHHHHHHTSSS   SHHHHHHTTTHHHHH:    
ExpBur          :bebbbebbeebeeebebebbebbbbbbeebbeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeebeeeeeeebebbeebeebebbebb:    
Contact         :            bb b b  b                              bbb                                     b    bb  

queryA       474:EALQNHENESVYKASLSLIEKYFSVE: 499
                :* ** ***   *     *** **  *:
3tj3_A_1     417:EFLQSHENQEIYQKAFDLIEHYFGTE: 442
SecStr          :HHGGG SSHHHHHHHHHHHHHHT   :    
ExpBur          :eebeeeebeebeeebeebbeebeeee:    
Contact         :bbbbbbb b  b   b  bb  bbbb                                                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123