Protein Model on 3tpm_A_1_B_1 (TEMPLATE: 3tpm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [14 aa] MAL 105S 107E 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 234S 235N 238R 270D 273W 277Y 281G 283N 286I 321V 322T 323G 328T 357W 360S 361N 396E 399W 403N 406S (identity: 100.0 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tpm_A_1 identity=94.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :**** ******** * * ************************************* ********************************************:
3tpm_A_1       1:NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 100
SecStr          :   HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTTHHHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbebbeeeeebbeebbeeebbebbbebbebe:    
Contact         :                              b b                              b   b   b bbbbb  b                   

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :******************** ******* ** *********** * ************************* **************** ******* ***:
3tpm_A_1     101:HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA: 200
SecStr          : HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebbeb:    
Contact         :      b  b   b  bb                                   b  b  bb  b                               b  b 

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :************ **** ************ ************************ ********************************************:
3tpm_A_1     201:ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 300
SecStr          :HHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbeebb:    
Contact         :  b   b b  b                                  bbb    b                            b  bb             

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :********* ************* ** **************************** ******* ************************************:
3tpm_A_1     301:NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 400
SecStr          :HTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbeebe:    
Contact         :                     b  b   b  b                                                                    

queryA       475:ALQNHENESVYKASLSLIEKYF: 496
                :*** *********** ******:
3tpm_A_1     401:ALQRHENESVYKASLNLIEKYF: 422
SecStr          :HGGG S HHHHHHHHHHHHHT :    
ExpBur          :ebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123