Protein Model on 3tx7_A_1_B_1 (TEMPLATE: 3tx7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [504 aa] Catenin beta-1 :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [218 aa] Nuclear receptor subfamily 5 group A member 2 :NR5A2_HUMAN 149S(Y) 150G 152S(Q) 155T(K) 191G(K) 195V 227R(Q) 231W 234S(R) 235N 266E(N) 269A(T) 270D(C) 403N(Q) 406S(E) (identity: 26.7 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tx7_A_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
3tx7_A_1     140:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 235
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbbbbb-bbbbbbeeeeebbeebeeeebbeebbebbee---eeeeebbbbbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                               bb b  b                                   b   b                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
3tx7_A_1     236:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 327
SecStr          : S HH-----HHHHHHHHHHHH---GGG TT  S HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbebbbebbebb---beebeebeebeebbeebbebbebeeeebbbbbbbbbbebbeebeebbbebbeeebbebbbebbeebeeeeebbeb:    
Contact         :            b   b  bb                              b  bb                                            

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQ--KEAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
3tx7_A_1     328:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQXXXXXXX: 419
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHHTSHHHHHHHHHTTHHHHHHHHHHHHHHTT -------:    
ExpBur          :bbbbbebbbbebeebeebbbbbeeeeb-bebbbebbeee-------bebebbebbbebbebbbebeebbeebeeeebbebbbebbeebeeeee-------:    

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
3tx7_A_1     420:XXXQFVEGVRMEEIV: 434
SecStr          :--- BSSS BHHHHH:    
ExpBur          :---eeeeebebeebb:    
Contact         :   b  b                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123