Protein Model on 3ukx_A_1_B_1 (TEMPLATE: 3ukx )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (C) polymer(polypeptide(L)) [23 aa] Bimax2 peptide 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y 280D 281G 283N 286I 311T 315R 319N 321V 322T 323G 325D 328T 350N 354E 357W 360S 361N 364A 365G 366R 396E 399W 402T 403N 406S 442D (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ukx_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
3ukx_A_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHTTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeebeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    
Contact         :                                bbbb  b                           b   b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
3ukx_A_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbeb:    
Contact         :         b  b   b  bb                                   b  b   b  b                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
3ukx_A_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHTSSSHHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbeeeeeebbebbbebbbebbebeeebbe:    
Contact         : b   b  bb b  b                        b   b   b bbb b  b                     b   b  b  bb  bbb     

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
3ukx_A_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebbbebbeebbeeebbebbbebbebeeeebbbbbbebbbbbbebbeeeeeeeebbeebeebebbe:    
Contact         :                        b  b  bb  b                                   b                             

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
3ukx_A_1     453:KIEALQRHENESVYKASLNLIEKYFS: 478
SecStr          :HHHHHTT SSHHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123