Protein Model on 3ul0_A_1_B_1 (TEMPLATE: 3ul0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (C) polymer(polypeptide(L)) [23 aa] Nuclear cap-binding protein subunit 1 :NCBP1_MOUSE 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y 281G 283N 286I 315R 319N 321V 322T 354E 357W 360S 361N 364A 396E 399W 403N 406S 407G (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ul0_A_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
3ul0_A_1      52:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 151
SecStr          : TTSS  HHHHHHHHTT  HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHH:    
ExpBur          :eebeebeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbeb:    
Contact         :                                 bbbb  b                           b   b   b bbbbb  b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
3ul0_A_1     152:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 251
SecStr          :TT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    
Contact         :          b  b   b  bb                                   b  b   b  b                                

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
3ul0_A_1     252:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 351
SecStr          :HHHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeebb:    
Contact         :  b   b   b b  b                            b   b bb                               b  b  bb  b      

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
3ul0_A_1     352:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 451
SecStr          :HHHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbbbbbebbbebbeebebebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeeeebe:    
Contact         :                         b  b   b  bb                                                               

queryA       471:DKIEALQNHENESVYKASLSLIEKYF: 496
                :******* *********** ******:
3ul0_A_1     452:DKIEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHHHTTS S HHHHHHHHHHHHHH :    
ExpBur          :eebeebeebeeeebeebbeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123