Protein Model on 3ve6_A_1_B_1 (TEMPLATE: 3ve6 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [12 aa] Venezuelan equine encephalitis virus capsid protein NLS :Q9WCF8_9VIRU 104L 105S 107E 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 273W 277Y 315R (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ve6_A_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
3ve6_A_1       1:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 100
SecStr          :   SS  HHHHHHHHTSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHTT SS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHH:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbebbebbbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbeb:    
Contact         :                                 bb b                              b   b   b bbbbb  b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
3ve6_A_1     101:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 200
SecStr          :TT S HHHHHHHHHHHHHHHHH HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHTT S HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeeebebbeebbeeebbeebbeebeeeebeeeeeebbeebbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbe:    
Contact         :          b  b  bb  bb                                      b   b  b                                

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
3ve6_A_1     201:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 300
SecStr          :HHHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHHTGGGTHHHHTT SSHHHHHHHHHHHHTTTTS HHHH:    
ExpBur          :bbebbbbbbeeeeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebbebbbbbbbebbebeeebb:    
Contact         :  b   b                                     b                                                       

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
3ve6_A_1     301:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 400
SecStr          :HHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHGGGGSS HHHHHHHHHHHHHHHHHHTTTTTHHHHHHHHHTTT H:    
ExpBur          :eebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebe:    

queryA       471:DKIEALQNHENESVYKASLSLIEKYF: 496
                :******* *********** ******:
3ve6_A_1     401:DKIEALQRHENESVYKASLNLIEKYF: 426
SecStr          :HHHHHHTT SSHHHHHHHHHHHHHT :    
ExpBur          :eebeebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123