Protein Model on 3wpt_A_1_I_1 (TEMPLATE: 3wpt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b I 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 263D (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3wpt_A_1 identity=100.0%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :****************************************************************************************************:
3wpt_A_1       1:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 100
SecStr          :   HHHHHHHHHSS HHHHHHHHHHHHHHHH SS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHTTTT S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbeebbeeeeeebbeebeeeebbeebeebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbebbebe:    

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :****************************************************************************************************:
3wpt_A_1     101:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 200
SecStr          :SHHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT  S GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbbbeb:    
Contact         :                                                                                        b           

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :****************************************************************************************************:
3wpt_A_1     201:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 300
SecStr          :HHHHTSS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT GGGHHHHHT SSHHHHHHHHHHHHHHTTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbeeeeeebbebbbbbbbebbebeeebbeebb:    

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :****************************************************************************************************:
3wpt_A_1     301:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 400
SecStr          :HTTHHHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeebeeebbebbbebbbebbeebeeebbeebbebebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeebebeeebe:    

queryA       475:ALQNHENESVYKASLSLIEKYF: 496
                :**********************:
3wpt_A_1     401:ALQNHENESVYKASLSLIEKYF: 422
SecStr          :TT  TTSHHHHHHHHHHHHTT :    
ExpBur          :ebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123