Protein Model on 3wpt_B_1_P_1 (TEMPLATE: 3wpt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [423 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b P 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 149S 150G 152S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3wpt_B_1 identity=100.0%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :****************************************************************************************************:
3wpt_B_1       1:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 100
SecStr          :   HHHHHHHHTSS HHHHHHHHHHHHHHHS SSS  HHHHHTTT HHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbeeebeeeeeeebeebeeeebbeebeebbebeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbebbebe:    
Contact         :                                                                          bb b                      

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :****************************************************************************************************:
3wpt_B_1     101:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 200
SecStr          :SHHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT  SSTTSS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbebbeeebebbeebbeeebbeebbeebeeeebeeeeeebbeebbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbbbeb:    

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :****************************************************************************************************:
3wpt_B_1     201:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 300
SecStr          :HHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbbbbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebbebbbbbbbebbebeeebbeebb:    

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :****************************************************************************************************:
3wpt_B_1     301:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 400
SecStr          :HTT HHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbebebbebbbebbebebeebbebbbebbbbbbebbeeeeeeeebbeebeebbbbeebe:    

queryA       475:ALQNHENESVYKASLSLIEKYFS: 497
                :***********************:
3wpt_B_1     401:ALQNHENESVYKASLSLIEKYFS: 423
SecStr          :TT  TTSHHHHHHHHHHHHHH  :    
ExpBur          :ebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123