Protein Model on 4b18_A_1_B_1 (TEMPLATE: 4b18 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [427 aa] IMPORTIN SUBUNIT ALPHA-1 :IMA1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [16 aa] TELOMERASE REVERSE TRANSCRIPTASE :TERT_HUMAN 105S 107E 138F 142W 146N 148A 149S 150G 155T 181Q 184W 188N 191G 192D 231W 235N 238R 270D 273W 277Y 280D 281G 283N 286I 315R 319N 322T 353K 354E 357W 360S 361N 392K(R) 396E 399W (identity: 97.1 %/50.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4b18_A_1 identity=50.8%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
4b18_A_1      21:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 120
SecStr          :HHHHHHTSS HHHHHHHHHHHHHHHH SS   HHHHHTSTTHHHHHHHHTT TT HHHHHHHHHHHHHHTSS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :ebeeebebeeeeebbebbeebbeebeeeeeebbeebeeeeebbeebbebbebeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    
Contact         :                         b b                               b   b   b bbb    b                       

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
4b18_A_1     121:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 216
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHGGG TT HHHH----HHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTTS  HHHHHHHHHHHHHH:    
ExpBur          :ebbbbebbbbbbeebeebbeebbeeebbeebbebbeeeeeeebb----ebbbebbbbbbeeeeeebeeeebeebbebbbebbeeebeebbbbbbebbbeb:    
Contact         :  b  b   b  bb                                      b   b  b                               b  b   b 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
4b18_A_1     217:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 316
SecStr          :TSSSHHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTH:    
ExpBur          :beeeeebbeebbebebbeebbebbebeeeebbebbbebbbbbbebeeebbeebbebebbebbeebbebeebebbebbbebbbebbebeeebbeebbeeeb:    
Contact         : bb b  b                            b   b  b                              bb  b  bb                 

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
4b18_A_1     317:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 416
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHHT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHHSS  S HHHHHHHHTTHHHHH:    
ExpBur          :bebbbebbeebeeebeebbbebbbbbbeebbeebbeebbeeebbebbbebbeeeeeebbebbbebbbbbbebbeebbeeeeeeebebbeebeebebbeeb:    
Contact         :             b   b  b                                                                               

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :* ** ***   *     *** **:
4b18_A_1     417:EFLQSHENQEIYQKAFDLIEHYF: 439
SecStr          :HHGGGSS HHHHHHHHHHHHHH :    
ExpBur          :eebeeeeeeebeeebeebeeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123