Protein Model on 4b8o_A_1_B_1 (TEMPLATE: 4b8o )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] IMPORTIN SUBUNIT ALPHA-1A :IMA1A_ORYSJ
2 b B 1 (B) polymer(polypeptide(L)) [11 aa] SV40TAGNLS 104L 105S 106R(I) 107E 108K(R) 110P 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 231W 235N 238R 270D 273W (identity: 91.3 %/52.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4b8o_A_1 identity=52.3%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*      *  *     ** **   ***** *  ***   *  *  * ** ** * *    *** ************* ** * * ** * *  ** *   :
4b8o_A_1      37:SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSD: 136
SecStr          : HHHHHHHHHSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S H:    
ExpBur          :eeeebeebbebeeeeebbebbbebeeebeeeeeeebeebbebebbebbbebbebeebeebbbbbbebbbbbbeeeeebbeebeeeebbeebbebbebebe:    
Contact         :                           bbbbb b                               b   b bbbb   b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********* ***    ****   **  **** *      *     *** ****** ** * * *        ** * ** *  * *** * *** *:
4b8o_A_1     137:DVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLIHSNDEEVLTDACWALS: 231
SecStr          :HHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHT STT  HHH----HHHHHHHHHHHH SS-S   HHHHTTHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbeeebeeeb----eeebbebbbbbbeee-eebebeebeebbebbbebbebebeebbbbbbebbb:    
Contact         :    b  b   b  bb                                      b   b  b                               b  b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :** ** *  *  *   ** * ** **         ****  ****** * ***  **  **    **** * *  * *** ** ******  **** * *:
4b8o_A_1     232:YLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN: 331
SecStr          :HHTSSSHHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHS   HHHHHHHHHHHHHHHTS HHHHHHHHH:    
ExpBur          :bbbeeeeebbebbbeeebbebbbebbebebeebbebbbebbbbbbebeeebbeebbeeebbebbebbbeeeeeeebbebbbebbbebbebeeebbebbbe:    

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEE: 466
                : *    **  *  * *   *** **  * ****   ** ***  * * **  **   *  *  * *    **     * *** *          * ** *:
4b8o_A_1     332:AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDE: 427
SecStr          :HT HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHH----HHHHHHHHHHT S  HHHHHHHH:    
ExpBur          :eebbeebbebbeebeeebeeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbb----ebbeeeeeeeeeeebebbeebee:    

queryA       467:CGGLDKIEALQNHENESVYKASLSLIEKYF: 496
                :  ** *** ** * *   *       * * :
4b8o_A_1     428:AEGLEKIENLQSHDNNEIYEKAVKILEAYW: 457
SecStr          :TTHHHHHHHGGG S HHHHHHHHHHHHHH :    
ExpBur          :bebbebbeebeeeeeeebeebbeebbeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123