Protein Model on 4b8p_A_1_C_1 (TEMPLATE: 4b8p )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [421 aa] IMPORTIN SUBUNIT ALPHA-1A :IMA1A_ORYSJ
2 b C 1 (C) polymer(polypeptide(L)) [7 aa] A89NLS 281G 283N 286I 321V 322T 323G 324T(D) 328T 357W 360S 361N 364A 396E 399W 402T(S) 403N 438L(T) 439V 442D(E) (identity: 78.9 %/52.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4b8p_A_1 identity=52.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :   *  *     ** **   ***** *  ***   *  *  * ** ** * *    *** ************* ** * * ** * *  ** *      *:
4b8p_A_1      41:MIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVRE: 140
SecStr          :HHHHHHSS HHHHHHHHHHHHHHH  SSS  HHHHHTTT HHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHH:    
ExpBur          :beebbeeeeeeebbebbbebbeebeeeeeebbeebbebebbebbbebbebeebeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebebeebbb:    

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :******** ***    ****   **  **** *      *     *** ****** ** * * *        ** * ** *  * *** * *** *** *:
4b8p_A_1     141:QAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSD: 235
SecStr          :HHHHHHHHHHHH HHHHHHHHHTT HHHHHTT STT  HHH----HHHHHHHHHHTT SS-S   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHHSS:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbeebbebbeeebeeeb----bebbbebbbbbbeee-eebebeebeebbebbbebbeeebeebbbbbbebbbbbbe:    

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV: 379
                :* *  *  *   ** * ** **         ****  ****** * ***  **  **    **** * *  * *** ** ******  **** * * *  :
4b8p_A_1     236:GTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVINAGII: 335
SecStr          :SSHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHS   HHHHHHHHHHHHHHTTS HHHHHHHHHHT H:    
ExpBur          :eeeebbebbbeeebbebbbebbeeebeebbebbbebbbbbbebeeebbeebbeeebbebbbebbeeeeeeebbeebbebbbebbebeeebbeebbeeebb:    
Contact         :b b  b                                  bbbb   b                             b  bb  b               

queryA       380:PFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEECGGL: 470
                :  **  *  * *   *** **  * ****   ** ***  * * **  **   *  *  * *    **     * *** *          * ** *  **:
4b8p_A_1     336:GPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDEAEGL: 431
SecStr          :HHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHGGGG S HHHHHHHHHHHHHHH----HHHHHHHHHTT SS HHHHHHHHTTHH:    
ExpBur          :eebbebbeebeeebeeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbb----ebbeeeeeeeeeeebebbeebeebebb:    
Contact         :                b  b  bb                                  bb  b                                     

queryA       471:DKIEALQNHENESVYKASLSLIEKYF: 496
                : *** ** * *   *       * * :
4b8p_A_1     432:EKIENLQSHDNNEIYEKAVKILEAYW: 457
SecStr          :HHHHGGGG S HHHHHHHHHHHHHH :    
ExpBur          :ebbeebeeeeeeebeebbbebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123