Protein Model on 4ba3_A_1_B_1 (TEMPLATE: 4ba3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [428 aa] IMPORTIN SUBUNIT ALPHA-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [6 aa] A89NLS 104L 105S 106R 110P 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 235N 238R (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ba3_A_1 identity=94.4%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :********* ******** * * ************************************* ***************************************:
4ba3_A_1      37:NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 136
SecStr          : GGGSS  HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeeeeeeebeebbeeeeeeebbebbbbbbbbbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbe:    
Contact         :                                  bbb   b                               b   b bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :************************* ******* ** *********** * ************************* **************** ******:
4ba3_A_1     137:LLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLA: 236
SecStr          :GGG S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbb:    
Contact         :           b  b   b  bb                                      b   b  b                               

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :* *************** **** ************ ************************ ***************************************:
4ba3_A_1     237:DSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 336
SecStr          :HHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHH:    
ExpBur          :ebbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeeb:    

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :************** ************* ** **************************** ******* *******************************:
4ba3_A_1     337:IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGG: 436
SecStr          :HHHHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeeeeb:    

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :******** *********** *******:
4ba3_A_1     437:LDKIEALQRHENESVYKASLNLIEKYFS: 464
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHH -:    
ExpBur          :beebeebeeeeeeebeeebeebbeebe-:    


Input Residue Numbers for Focused Sites

ex) 2,15,123