Protein Model on 4bpl_A_1_B_1 (TEMPLATE: 4bpl )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] IMPORTIN SUBUNIT ALPHA-1A :IMA1A_ORYSJ
2 b B 1 (B) polymer(polypeptide(L)) [21 aa] NUCLEOPLASMIN NLS 104L 105S 106R(I) 107E 110P 138F 142W 146N 148A 149S 150G 151T 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 240K 273W 277Y 315R 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W 403N 406S (identity: 97.4 %/52.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4bpl_A_1 identity=52.3%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*      *  *     ** **   ***** *  ***   *  *  * ** ** * *    *** ************* ** * * ** * *  ** *   :
4bpl_A_1       1:SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSD: 100
SecStr          : HHHHHHHHTSS HHHHHHHHHHHHHHHSSSSS  HHHHHHTT HHHHHHHHS TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S H:    
ExpBur          :eeeebeebbebeeeeebbebbbebbeebeeeeeeebeebbebebbebbbebbeeeebeebbebbbebbbbbbeeeeebbeebeeeebbeebbebbebebe:    
Contact         :                           bbbb  b                           b   b   b bbbb   b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********* ***    ****   **  **** *      *     *** ****** ** * * *        ** * ** *  * *** * *** *:
4bpl_A_1     101:DVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLIHSNDEEVLTDACWALS: 195
SecStr          :HHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHT STT  HHH----HHHHHHHHHHHH SS-S   HHHHTTHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebebbbbebbbbbbeeeeebbeebbeeebbeebbebbeeebeeeb----eebbbebbbbbbeee-eebebeebeebbebbbebbeeeeeebbbbbbebbb:    
Contact         :    b  b  bb  bb                                      b   b  b b                                b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :** ** *  *  *   ** * ** **         ****  ****** * ***  **  **    **** * *  * *** ** ******  **** * *:
4bpl_A_1     196:YLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN: 295
SecStr          :HHTSS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHSS  HHHHHHHHHHHHHHHTS HHHHHHHHH:    
ExpBur          :ebbeeeeebbebbbeeebbebbbebbebebeebbebbbebbbbbbebeeebbeebbeeebbebbbebbeeeeeeebbebbbbbbbebbebeeebbeebbe:    
Contact         :b                                     b     bbb    b                          b  b  bb  b           

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEE: 466
                : *    **  *  * *   *** **  * ****   ** ***  * * **  **   *  *  * *    **     * *** *          * ** *:
4bpl_A_1     296:AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDE: 391
SecStr          :HT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHTTT S HHHHHHHHHHHHHHH----HHHHHHHHHHT SS HHHHHHHH:    
ExpBur          :eebbeebbebbeebeeebeebbbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbbbbb----ebbeeeeeeeeeeebebbeebee:    
Contact         :                    b  b   b  b                                                                     

queryA       467:CGGLDKIEALQNHENESVYKASLSLIEKYF: 496
                :  ** *** ** * *   *       * * :
4bpl_A_1     392:AEGLEKIENLQSHDNNEIYEKAVKILEAYW: 421
SecStr          :TTHHHHHHHGGG S HHHHHHHHHHHHHH :    
ExpBur          :bebbebbeebeeeeeeebeebbbebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123