Protein Model on 4d49_E_1_J_1 (TEMPLATE: 4d49 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) E 1 (E) polymer(polypeptide(L)) [239 aa] ARMADILLO REPEAT PROTEIN ARM00027
2 b J 1 (E) non-polymer(ARG) ARGININE 276S 311T(K) 312P(E) 315R(W) 354E (identity: 40.0 %/35.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4d49_E_1 identity=35.7%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
4d49_E_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 105
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHH:    
ExpBur          :beebbebbebeeeeebbebbeebbebbeeeeeebeebbeeebbebbbebbeeeeeebbeebbebbbebbebeeebbeebbebebbebbbebbeebeeebb:    
Contact         :                       b                                  bb  b                                     

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                :*** *   **  *   ***     *    **  *  *     ******  *  **   ***  *   *   **  **       *     ** **     :
4d49_E_1     106:KEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN: 204
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHTTS H-HHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHTS H:    
ExpBur          :ebbbebbbbbbebeeebbeebbeeebbebbbebbeebeeebbebbbbbbbbbbebee-ebbeebbeeebbebbbebbeeeeeebbebbbebbbebbebee:    
Contact         : b                                                                                                  

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :            ** * *   * ** * ** * *      *   *:
4d49_E_1     205:EMKQK------LEEAGALPALEKLQSHANEEVQKNAQAALEAFNS: 243
SecStr          :HHHHH------HHHTTHHHHHHGGGG S HHHHHHHHHHHHH  -:    
ExpBur          :ebbee------beeeebbebbeebeeeeeeebeebbeebbeeee-:    


Input Residue Numbers for Focused Sites

ex) 2,15,123