Protein Model on 4d49_F_1_H_1 (TEMPLATE: 4d49 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) F 1 (F) polymer(polypeptide(L)) [239 aa] ARMADILLO REPEAT PROTEIN ARM00027
2 b H 1 (H) polymer(polypeptide(L)) [9 aa] POLY ARG DECAPEPTIDE 277Y(Q) 280D(S) 281G 282P(G) 315R(W) 319N 322T(S) 323G 324T(N) 325D(N) 328T(I) 353K 354E 357W 361N 363T(A) 364A(S) 365G 366R(N) 367Q(N) 399W 403N 406S 407G 409T(N) 439V(E) 442D(W) 446N 449Q(S) (identity: 44.8 %/35.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4d49_F_1 identity=35.7%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
4d49_F_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 105
SecStr          :HHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHH:    
ExpBur          :beebbeebebeeeeebbebbeebbebbeeeeeebeebbeeebbebbbebbeeeeeebbeebbebbbebbebeeebbeebbeeebbebbbebbeebeeebb:    
Contact         :                        b  bbb                                b   b  bbbb  b                        

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                :*** *   **  *   ***     *    **  *  *     ******  *  **   ***  *   *   **  **       *     ** **     :
4d49_F_1     106:KEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN: 204
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHTTS H-HHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHTS H:    
ExpBur          :ebbbebbbbbbebeeebbeebbeeebbebbbebbeebeeebbebbbebbbbbbebee-ebbeebbeeebbebbbebbeeeeeebbeebbebbbebbebee:    
Contact         :bb  b   b bbbbb                               b   b  bb b                             b  b   b  b   

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :            ** * *   * ** * ** * *      *   *:
4d49_F_1     205:EMKQK------LEEAGALPALEKLQSHANEEVQKNAQAALEAFNS: 243
SecStr          :HHHHH------HHHTTHHHHHHHGGG SSHHHHHHHHHHHHHT -:    
ExpBur          :ebbee------beeeebeebbeebeeeeeeebeebbeebbeebe-:    


Input Residue Numbers for Focused Sites

ex) 2,15,123