Protein Model on 4d4e_A_1_C_1 (TEMPLATE: 4d4e )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [239 aa] ARMADILLO REPEAT PROTEIN ARM00016
2 b C 1 (A) non-polymer(GOL) GLYCEROL 438L(K) 441L(V) 442D(A) 445S(A) 487A(N) 490S(A) 491L(A) (identity: 0.0 %/32.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4d4e_A_1 identity=32.8%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
4d4e_A_1      14:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 113
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHH:    
ExpBur          :beebbeebebeeeeebeebbeebeebbeeeeeebeebbeeebbebbbebbeeeeeebbebbbebbbebbebeeebbeebbebebbebbbebbebeeeebb:    

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                :* *     ** **   ***     *    **  *  *     *    *       *  ***  *   *   **  **       *     ** **     :
4d4e_A_1     114:KNAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNN: 212
SecStr          :HHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S HHHHH-HHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHTS H:    
ExpBur          :bbbbbbbbebbebeeebbbebbebebbeebbebbeeebeebbe-ebbbbbbebbebeeebbeebbebebbebbbebbeeebeebbebbbebbeebbebee:    
Contact         :                                                                                     b  bb  b       

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :            ** * *   * ** * ** * *      *   *:
4d4e_A_1     213:EMKQK------LEEAGALPALEKLQSHANEEVQKNAQAALEAFNS: 251
SecStr          :HHHHH------HHHHTHHHHHHHGGGSS HHHHHHHHHHHHHT -:    
ExpBur          :ebbee------beeeebeeebeebeeeeeeebeeebeebbeebe-:    
Contact         :                                  b  bb                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123