Protein Model on 4d4e_B_1_E_1 (TEMPLATE: 4d4e )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [239 aa] ARMADILLO REPEAT PROTEIN ARM00016
2 b E 1 (B) non-polymer(GOL) GLYCEROL 365G 366R(N) 367Q(N) 370I 405T(I) 408G 409T(N) 412Q (identity: 50.0 %/32.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4d4e_B_1 identity=32.8%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
4d4e_B_1      14:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 113
SecStr          :HHHHHHGGG S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHTTT S HHHH:    
ExpBur          :beebbeebebeeeeebbebbeebbeebeeeeeebeebbeeebbebbbebbeeebeebbebbbbbbbebbebeeebbbebbeeebbeebbebbebebeebb:    

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                :* *     ** **   ***     *    **  *  *     *    *       *  ***  *   *   **  **       *     ** **     :
4d4e_B_1     114:KNAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIK-NAVAAIANIAAGNNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNN: 212
SecStr          :HHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTTTS HHHHH-HHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHS H:    
ExpBur          :ebbbbbbbebbeeeeebbeebbeeebbeebbebbeeeeeebbe-bbbbbbbebbeeeeebbeebbebebbebbbebbeeebeebbbebbebbeebbeeee:    
Contact         :            bbb  b                                  b  bb  b                                        

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :            ** * *   * ** * ** * *      *   *:
4d4e_B_1     213:EMKQK------LEEAGALPALEKLQSHANEEVQKNAQAALEAFNS: 251
SecStr          :HHHHH------HHTTTHHHHHHGGGG SSHHHHHHHHHHHHTT -:    
ExpBur          :ebbee------beeeebbeebeebeebeeeebeeebeebbeebe-:    


Input Residue Numbers for Focused Sites

ex) 2,15,123