Protein Model on 4db8_A_1_E_1 (TEMPLATE: 4db8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [247 aa] Armadillo-repeat Protein
2 b E 1 (A) non-polymer(MG) MAGNESIUM ION 459K (identity: 100.0 %/40.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4db8_A_1 identity=40.9%
queryA       253:LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI: 351
                :**     *  **  * *  *      * ** ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *:
4db8_A_1      14:LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 112
SecStr          :HHHHHHHHHSS SSHHHHHHHHHHHHHHHH-HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHH:    
ExpBur          :eeebeebeeeeeeeeeeebeeeeeeeeeee-eeeeeeebeeeebeebbeebebeeeeebeebbeebbebbeeeeebbeebbebebbebbbebbebeeeeb:    

queryA       352:QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAA: 451
                :  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  ***      *    *  **      *    * * ***    :
4db8_A_1     113:LQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG-: 210
SecStr          :HHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS H-HHHHHHHHTT HHHHHHGGG SSHHHHHHHHHHHHHHTTS-:    
ExpBur          :beebbebbbbbbebeeebbbebbeeebbeebbebbeeebeebbebbbebbbbbbebee-ebbbbbbeeebbebbbebbebeeeebbeebbebbbbbbeb-:    

queryA       452:EKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY: 495
                :   *   *      * * * * * ** ****   *      ** :
4db8_A_1     211:---GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKL: 249
SecStr          :--- HHHHHH--HHHTTHHHHHHTTTT SSSHHHHTHHHHHHTT:    
ExpBur          :---eeebeee--beeebbeeebeebeeeebeebeeebeebeeeb:    
Contact         :       b                                                                                            


Input Residue Numbers for Focused Sites

ex) 2,15,123