Protein Model on 4db8_D_1_A_1 (TEMPLATE: 4db8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [246 aa] Armadillo-repeat Protein
2 b A 1 (A) polymer(polypeptide(L)) [247 aa] Armadillo-repeat Protein 253L 257V(T) 260L 261H(N) 267V(Q) 268L 271T 272C(R) 274A(F) 275I(S) 277Y(I) 278L 279T(S) 281G 283N 285R(Q) 286I 288M(A) 289V 291K(D) 292T(A) 293G 294V(A) 297Q(A) 298L 301L 304A(S) 306E(N) 308P(Q) 309I 312P(E) 315R(W) 316A 319N 320I 322T(S) 323G 324T(G) 325D(N) 364A(S) 368D(E) 406S 409T(N) 450A(G) 455G (identity: 42.2 %/40.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4db8_D_1 identity=40.9%
queryA       253:LPTLVRLLHHDD-PEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNI: 351
                :**     *  **  * *  *      * ** ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *:
4db8_D_1      14:LPQMTQQLNSDDMQEQLSATRKFSQILSDG-NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 112
SecStr          :HHHHHHHHSSS HHHHHHHHHHHHHHHHHH-HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHH:    
ExpBur          :eeebeeeeebeeeeeeeebeeeeeeeeeee-eeeeeeebeeeebeebbeebebeeeeebeebbeebbebbeeeeebbebbbebebbebbbebbebeeeeb:    
Contact         :b   b  bb   b  bb  bb bb bbb b b bb bb bbbb  bb  b  b b bb  b  bb  bb bbbb                          

queryA       352:QKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAA: 451
                :  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  ***      *    *  **      *    * * ***    :
4db8_D_1     113:LQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG-: 210
SecStr          :HHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHTTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTT HHHHHHTTSSS TTHHHHHHHHHHHHTTS-:    
ExpBur          :bebbbebbbbbbebeeebbbbbbeeebbeebbebbebeeeebbebbbebbbbbbebee-ebbbbbbeeebbeebbebbeeeeeebbebbbebbbbbbeb-:    
Contact         :            b   b                                     b  b                                        b 

queryA       452:EKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKY: 495
                :   *   *      * * * * * ** ****   *      ** :
4db8_D_1     211:---GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKL: 249
SecStr          :--- HHHHHH--HHTTTHHHHHHGGGG S HHHHHHHHHHHTT :    
ExpBur          :---eeebeee--beeebbeeebeebeeeeeeebeebbeebeeeb:    
Contact         :   b                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123