Protein Model on 4dba_D_1_C_1 (TEMPLATE: 4dba )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [196 aa] Designed Armadillo repeat protein, YIIM3AII
2 b C 1 (C) polymer(polypeptide(L)) [196 aa] Designed Armadillo repeat protein, YIIM3AII 299V(T) 302L 303G(N) 307L(M) 310V(Q) 311T(L) 314L(T) 315R 317I(F) 318G(S) 320I 321V(L) 322T(S) 324T(G) 325D(N) 327Q 328T(I) 330V(A) 331V 334A 335G 336A 339V(A) 343L 350N(Q) 351I 354E 355A 357W 358T(A) 361N 362I 364A(S) 365G 366R(G) 367Q(N) 406S 409T(N) (identity: 44.7 %/38.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4dba_D_1 identity=38.1%
queryA       295:VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ: 394
                : **    *          * *    *     ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **       :
4dba_D_1      14:LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQIL: 113
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHH:    
ExpBur          :eeebeebeeeeeeeeeeebeeebeeeeeeeeeeeeeebeeeebeeebeebebeeeeebeebbeebbebbeeeeebbeebbebebbeebbebbeeeeeebb:    
Contact         :    b  bb   b  bb  bb bb bbb bb bb bb  bbb  b   b      bb  bb bb  bb bbbb                           

queryA       395:KEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK: 494
                : ** **  *  ***  ***      *    *  **      *    * * ***       *   *      * * * * * ** ****   *      **:
4dba_D_1     114:QEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEALEK: 206
SecStr          :HHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHTTS S HHHHHHHHHHHHHHHTS---- HHHHHHH--HTTTHHHHHHHTTT SSHHHHHHHHHHHHH:    
ExpBur          :eebbebbbbbbebbe-ebbeebbeeebbeebbebbebeeeebbeebbebbbbbbeb----eeebeeeb--eeeebeeebeebeebeeeebeebbeebbee:    
Contact         :           b  b                                                                                     

queryA       495:Y: 495
                : :
4dba_D_1     207:L: 207
SecStr          :H:    
ExpBur          :b:    


Input Residue Numbers for Focused Sites

ex) 2,15,123